There was an issue with the vue-server-renderer where the render function or template was not defined in the component

In my project with Vue 2.7 and webpack4 for SSR, I encountered an error message stating: 

render function or template not defined in component: anonymous
. This issue arises under the following circumstances:

  1. When using a child component.
<template>
  ...
</template>

<script>
import componentA from '. /componentA''

export default {
...
  component: {componentA},
}
<script>
  1. Importing from external files (both named export and default export).

Default Export:

const somethingFunc = () => {}
export default somethingFunc

Named Export:

export const somethingFunc = () => {}

Vue Component File:

<template>
  ...
</template>

<script>
import somethingFunc from '... /external.js'

export default {
...
  computed: {
  something() {
      return somethingFunc()
      }
    }
  }
}
</script>
  1. Using mixins imported with named export.
export const Mixin = {
  props: {...} ,
  methods: {...}
}

This is the list of dependencies stated in package.json:

  "dependencies": {
    "axios": "^0.21.4",
    "clean-webpack-plugin": "^4.0.0",
    "core-js": "^3.7.0",
    "deepmerge": "^4.2.2",
    "express": "^4.17.1",
    "knex": "^2.4.0",
    "lodash": "^4.17.20",
    "lozad": "^1.16.0",
    "lru-cache": "^7.14.1",
    "md5": "^2.3.0",
    "moment": "^2.29.1",
    "numeral": "^2.0.6",
    "pg": "^8.8.0",
    "serve-favicon": "^2.5.0",
    "vue": "^2.7.14",
    "vue-server-renderer": "^2.7.14"
  },
  "devDependencies": {
    ...
  }

I have searched for similar errors but could not find any solutions. Any insights on this issue would be greatly appreciated. It's worth noting that without these conditions, the rendering works correctly.

javascriptvue.jswebpackserver-side-renderingvue-server-renderer

Answer №1

Consider updating your import declarations. When importing child components, follow this format:

import ChildComponent from '../ChildComponent.vue'

export default {
  components: {
    ChildComponent
  }
}

For function imports, use the following syntax:

import {myFunction} from "../myFile"

Answer №2

I was able to find a solution on my own. There were several reasons for the issue I encountered. Firstly, the error with the component was due to using dynamic importing of a component with a variable.

<template>
  <div>
    <component :is="getComponentIs()" />
  </div>
</template>

<script>
export default {
...
computed: {
  getComponentIs() {
    return Vue.component(compName, () => import( 
           '../components/' + this.componentName + '.vue') 
         ))
  }
}
...
}
</script>

The issue with the component was resolved by explicitly defining all components like so.

export default {
  components: {
    ComponentA: () => import('../components/ComponentA.vue')
   ...
  }
}

Secondly, the problem when importing an external file was caused by bringing in an external library within the file
external.js.

import numeral from 'numeral'
export const something = [...].

Removing the import statement fixed the issue.

Similar questions

If you have not found the answer to your question or you are interested in this topic, then look at other similar questions below or use the search

Angular-Loopback-SDK: The method prototype$updateAttributes is not functioning as expected

I'm currently utilizing the loopback-angular-sdk and encountering a strange error while using the updateAttributes function: MyModel.prototype$updateAttributes is not a function This issue seems to be affecting all models. I have a hunch that it mig ...

javascriptangularjsloopbackangular-loopback

Showcasing the information stored within my li element, I am able to access and view the data through my console

I want to showcase the data in the browser Upon hitting the api call, I retrieve the data in my console. The challenge lies in displaying the data within my li tag. Below are snippets of my relevant code and the entire code can be found in the gist links p ...

javascripthtmlangularangular2-templateangular6

When the color is set in Tip Tap, bold or italic text does not display

Utilizing Vue Tiptap along with the Color extension has been an interesting experience for me. I've encountered an issue where after making edits, the HTML is retrieved and stored in Firestore. However, when a color is set, the editor fails to display ...

vue.jstiptap

I am curious about the significance of the "=>" symbol within the Ionic framework

I utilized the documentation provided on the Ionic website to incorporate Firebase into my mobile application. this.firebase.getToken() .then(token => console.log(`The token is ${token}`)) // store the token server-side and utilize it for sending not ...

javascriptandroidangulartypescriptionic-framework

NodeJS Request Body Not Populated

Currently operating with node using [email protected] and [email protected]. Within my jade page, there exists a property like this: input(type='text',class='form-control', placeholder="Username", name='username', ...

javascriptnode.jsexpressbody-parser

Add-on or code snippet for Node.js that allows for optional regex groups

Strings in Sequence line 1 = [A B C] line 2 = [A C] line 3 = [B C] Regular Expression /\[?(?<groupA>[A])?(?:[ ]*)?(?<groupB>[B])?(?:[ ]*)?(?<groupC>[C])\]/gm Is there a way to achieve the desired output using a plugin or spe ...

javascriptregexnode.js

Leverage the power of Laravel and ReactJS to beautifully display images

Currently, I am working on a project where I am incorporating ReactJS into a Laravel blade file. To get started, I included the React CDN and began writing code within the script tag. Everything seems to be going smoothly so far, however, I have encountere ...

javascriptphpreactjslaravel

Accessing multi-dimensional array properties in PHP with JavaScript integration

In my PHP code, I have an array structured like this: <?php $data = array(); $data[0] = array('year' => 2001, 'month' => array( 'January' => array('val1' => 1000, 'v ...

javascriptphpjsonassociative

What is the method for retrieving an array or object that contains a collection of files designated for uploading within the jQuery file upload plugin?

Currently, I have successfully integrated a form into my Rails site and set up the jQuery file upload plugin. The upload form functions properly with the ability to select multiple files and utilize all ajax upload features. However, a challenge I am faci ...

javascriptjqueryajaxformsfile-upload

What is the best method for saving console.log output to a file?

I have a tree structure containing objects: let tree = {id: 1, children: [{id: 2, children: [{id: 3}]}]} My goal is to save all the id values from this tree in a text file, indenting elements with children: 1 2 3 Currently, I am using the following ...

javascripttypescript

Update the parent node in the Google Org Chart

This is my first time working with Google Charts and I have a couple of questions: Is there a method in the API to update the parent of an existing node? I am facing a challenge where I need to build a tree structure top-down, which means that I know the ...

javascriptjqueryhtmlcssgoogle-visualization

Using dynamic import to pull in the map from an npm package.json in JavaScript

Is there a way to set up path mapping for pure JavaScript imports? Currently, when we want to import npm packages in pure JS without using webpack, the syntax is different. Instead of just using import package from 'package-name', we have to use ...

javascriptnpmpackagedynamic-import

Fill in the select dropdown menu

I am trying to trigger the population of a select dropdown when the user clicks on it. The issue I am facing is that the click handler seems to be activated only when the user clicks on the options within the select, whereas in my case there are no optio ...

javascriptjquery

Arranging a string array in JavaScript according to an integer array

Looking at the provided javascript arrays: letterArray ['a', 'e', 'i', 'o', 'u'] We also have another array that corresponds to it: valueArray [12, 22, 7, 7, 3] The goal is to sort the valueArray into: ...

javascriptsorting

The UseEffect function is displaying an inappropriate value, however, it only occurs once

My goal is to display the state value whenever the password is changed using the useEffect hook in React. It's working fine for the password, but the issue arises when I try to change the email. The console also renders the email value, which is not i ...

javascriptreactjsuse-effect

How can I fix my HTML Image input not redirecting when clicked?

I have successfully implemented the following code: <input type="button" name="btnHello" value="Hello" onclick="Test();"/> Here is the JS function that accompanies it: function Test() { window.location.href = "Page2.aspx"; } Initially, clicking ...

javascripthtmlimagehttp-redirectimagebutton

Turning off the transpiler in Vue Webpack to simplify the debugging process

Debugging in Vue can be quite challenging, especially when it comes to setting breakpoints and stepping through the code. The issue seems to stem from the transpiling of javascript ES6/ES2015/ES2016/ES2017 to ES5. While source maps provide some assistance, ...

javascriptdebuggingvue.jswebpackgoogle-chrome-devtools

Can a new EJS file be generated using the existing file as a template?

I am in the process of building a website navbar and I am curious about how to automatically inject code from one ejs file into another ejs file. In Python's Flask framework, this is accomplished using the principle of {% block title%} and in another ...

javascriptexpressejs

While developing my Vue.js project, I encountered an unexpected issue

I started a fresh project using Vue Js and encountered an issue. Code snippet: export default { name: 'welcome', mounted: function() { $(window).load(function() { $('.flexslider').flexslider({ animation: "slide", ...

vue.js

Setting a Javascript value to a Controller variable within an ASP.NET MVC View

I am trying to set the javascript variable contentArea to match content.Contents in my controller. How can this be accomplished? <script language="javascript" type="text/javascript"> $("#btnTest").click(function () { var content ...

javascriptjqueryasp.net