What is the process for importing npm scoped packages with @ symbol in Deno?

Having some trouble with importing @whiskeysockets/baileys in Deno. Here's the code snippet I'm using:

import * as a from "npm:@whiskeysockets/baileys";
console.log(a);

When I try to run deno run main.ts, it throws the following error:

Error in @whiskeysockets parsing version requirement for dependency: libsignal@github:adiwajshing/libsignal-node

Invalid npm version requirement. Unexpected character.
  github:adiwajshing/libsignal-node
  ~

Caused by:
    0: Invalid npm version requirement. Unexpected character.
         github:adiwajshing/libsignal-node
         ~
    1: Unexpected character.
         github:adiwajshing/libsignal-node

I suspect that 'whiskeysockets' is being mistaken as a version number instead of a scope namespace due to the '@' symbol. Any guidance on how to resolve this and import it correctly?

javascriptgithubnpmdeno

Answer №1

If you're looking to accomplish this task, one method is through esm.sh

import * as a from "https://esm.sh/@whiskeysockets/baileys";

This approach involves fetching GitHub repositories and saving them to a node_modules directory in the current working folder. This can be done to access the source code of your project.

async function fetchGitHubRepoAndSaveToNodeModules(url) {
  return new Deno.Command("/bin/sh", {
    /*
    cd node_modules/.deno
    git clone "$1"
    cd ..
    ln -s  "`pwd`/.deno/$2" "`pwd`"
  */
    args: [
      "install_from_github.sh",
      url,
      url.split("/").pop(),
    ],
  }).output();
}

const { code, stdout, stderr } = await fetchGitHubRepoAndSaveToNodeModules(
  "https://github.com/guest271314/wbn-sign-webcrypto",
);

console.log([stdout, stderr].map((result) => decoder.decode(result)));

Similar questions

If you have not found the answer to your question or you are interested in this topic, then look at other similar questions below or use the search

Ensure that the React Material UI Textfield with the type "number" is validated to have exactly 10 characters

<TextField variant="outlined" required fullWidth id="accno" label="Main Account Number" type="number" name="accno" //inputProps={{ className:"input-acc", pattern: "^.{0,10}$"}} autoComplete="accno" onChange={(e) = ...

javascripthtmlreactjsformsmaterial-ui

Ways to exclusively allow cookies from my API server

I am running an Expressjs API server on localhost:4000, and my client on localhost:8008. Is there a way to ensure that my client only accepts cookies originating from my API server? At the moment, I am using fetch with credentials: 'include' to ...

javascriptnode.jsexpressfetchsession-cookies

receiving a pair of components instead of just one

Here is the code for router.js: import React from 'react'; import { Route } from 'react-router-dom'; import CommentList from './containers/commentview'; import CommentDetalList from './containers/commentdetailview'; ...

javascriptnode.jsreactjsreact-router-dom

ERROR: No compatible version of jQuery Foundation could be located

Encountering issues while installing Foundation due to conflicts with Jquery. λ bower install foundation bower foundation#x cached https://github.com/zurb/bower-foundation.git#5.5.1 bower foundation#x validate 5.5.1 against https: ...

javascriptjqueryjsonzurb-foundationbower

Utilizing attributes as scope properties within AngularJS

I am currently working on a directive and I need to pass the Attributes (Attrs) to the $scope, however, I am facing some difficulties in achieving this. Specifically, my goal is to assign attributes in my template based on the name set in my date-picker ta ...

javascriptangularjsangularjs-directive

Error: Failed to locate package "package-name" in the "npm" registry during yarn installation

While working on a large project with numerous sub-projects, I attempted to install two new packages. However, YARN was unable to locate the packages despite the .npmrc being present in the main directory. ...

typescriptnpmyarnpkg

"Troubleshooting: ngForm.controls returning undefined value in Angular application

Trying to test this HTML code in Angular: <form name="formCercarUsiari" #formCercarUsuari="ngForm" class="tab-content"> <input #inputNif class="form-control input-height" maxlength="100" type="text" placeholder="Indiqui NIF" name="nif" i18n-pla ...

javascripthtmlangulardomundefined

Tips for accessing the "data" of a PHP array using AJAX

My code snippet using Ajax: $.ajax({ type: 'post', url: 'url.php', dataType: 'JSON', success: function(data) { id = // Need to extract the ID data from 'data' } }); ...

javascriptphpajax

The wrapAll() method can be used to wrap list items within two columns

I am looking to group multiple li elements within two div containers by using jQuery's wrapAll method. The challenge lies in the fact that these items are rendered within a single <ul> element via a CMS. Here is the current setup: <ul> ...

javascriptjqueryhtmlcss

What are some ways to streamline this D3 script?

My CSV data displays pass rates by organisation for different years: org,org_cat,2004_passed,2004_total,2005_passed,2005_total,2006_passed,2006_total GSK,industry,35,100,45,100,55,100 I am using D3 and aiming to create a dictionary of organisations struc ...

javascriptd3.js

Update the page when the React route changes

I am facing an issue with a function in a component that is supposed to load certain variables when the page is fully loaded. Interestingly, it works perfectly fine when manually reloading the page. However, if I use a NavLink to navigate to the page, the ...

javascriptreactjsreact-router

Exploring ways to personalize the parsing of url query parameters in express.js

When using req.query, the hash of query parameters is returned. Additionally, if a parameter consists of a JSON object, it is automatically parsed into JSON format, which is quite impressive. However, I am curious about customizing this parsing process. I ...

javascriptnode.jsexpress

Variability in Focus Behavior while Opening a URL in a New Tab with window.open()

Here is a code snippet I have been using to open a URL in a new tab: window.open(urlToOpen, '_blank', 'noopener noreferrer'); The issue I am experiencing is that when this code is executed for the first time, it opens the URL in a new ...

javascripthtmltypescripturlbrowser

Injecting cascading style sheets across different domains using Javascript

Put simply: Is it possible for an external Javascript code to inject another script that is hosted on a completely different domain into the page's Document Object Model (DOM)? For example: Imagine the website foo.com which has an html script tag w ...

javascriptbrowsercross-domain

Javascript event triggering twice

I have created this code snippet to showcase the issue I am facing. main.php <body> //some html <script> function fx1(){ $(".elem").click(function(){ alert("hello"); }) } </script> //some html again include sub-acc.php & ...

javascriptjqueryjquery-mobilejquery-events

The pagination feature for Swiper is experiencing issues across both desktop and mobile platforms

I am having an issue with the pagination display in the text. I would like it to appear below the text as a standalone item for better visibility. Another problem arises when viewing the page on mobile devices - the hamburger menu displays behind the slid ...

javascripthtmlcssswiper.js

What could be causing the issue where only the latest data is being shown

When I use ajax to retrieve data from my database, the console.log displays all the results correctly, but in my HTML, only the last result is shown. What could be causing this issue? Any help would be appreciated! Thanks! Please keep your response simple ...

javascriptphphtmlajax

eliminate the offspring of a component (chessboard)

Hey there! I'm currently working on developing a chess game and I could really use your expertise to help me solve an issue. In my code, when I try to move a piece in the game, this is what happens: 1. First, I remove the existing piece from its cu ...

javascripthtmlcsschess

What is the best method for adding anchors or appending items in aspx pages?

I have created code for an image gallery on my webpage, "gallery.aspx". The situation is that I have an external aspx page with various links. When a user clicks on one of these links, I want them to be redirected to the image gallery but to a specific ima ...

javascripthtmlasp.netimagehyperlink

Ways to execute a JavaScript function upon a button click instead of during the page load completion

I searched on Google but couldn't find the answer, so I'm asking here for help. In the attached screenshot located at the end, when the user clicks on the download button, some backend actions are performed such as file transfer. Once the proces ...

javascriptc#jqueryhtml