iOS device encounters failure with Ajax CORS request and redirect

I am experiencing an issue where a URL is being redirected to another domain by the server. My test code is very simple:

$.ajax({
        type:"GET",  
        url:"{MYURL}",  
        success:function(d){alert('response');}  
 })

You can check out the live script here.

Despite receiving the "response" alert on all browsers and platforms, I am facing an issue with iOS (iPhone/iPad) which displays the error message "Cannot make any requests from null". Any assistance would be greatly appreciated.

Ofer

javascriptiosajaxcors

Answer №1

Looks like there was a glitch in the iOS system
The issue seems to be resolved in iOS version 10.1.1

Similar questions

If you have not found the answer to your question or you are interested in this topic, then look at other similar questions below or use the search

Extract string data from JSON payload

How can I extract the itemlocation from itemInfo and display it in a new column in my react table using Material UI? While I know this can be done on the backend, I am looking for a way to achieve this without backend involvement. Below is an example of ho ...

javascriptnode.jsreactjsmaterial-ui

What is the easiest and most straightforward method for deploying HTML and JavaScript in Service Mix?

I am currently working on a small HTML/web page project and I am interested in deploying service mix. Although I have knowledge of the web page side and I am familiar with service mix, I haven't ventured into using a simple HTML/JavaScript setup withi ...

javascripthtmlapache-karafkaraf

What is the best way to handle waiting for a request and user input simultaneously?

Imagine a scenario where a component loads and initiates an asynchronous request. This component also includes a submit button that, when clicked by the user, triggers a function that depends on the result of the initial request. How can I ensure that this ...

javascriptvue.jsasynchronous

Executing multiple AJAX calls at the same time in PHP

I have a puzzling question that I can't seem to easily solve the behavior of this situation There are two ajax call functions in my code: execCommand() : used for executing shell commands through PHP shell_exec('ping 127.0.0.1 > ../var/log/ ...

javascriptphpjqueryajax

Utilizing Ionic Storage to set default request headers through an HTTP interceptor in an Angular 5 and Ionic 3 application

I'm attempting to assign a token value to all request headers using the new angular 5 HTTP client. Take a look at my code snippet: import {Injectable} from '@angular/core'; import {HttpEvent, HttpInterceptor, HttpHandler, HttpRequest} from ...

javascriptangulartypescriptionic2ionic3

Create a filter system using a MERN stack that incorporates regex, a search box,

In an effort to understand how the MERN stack operates as a cohesive unit, I have taken on a hands-on approach by following tutorials from bezcoder. These include guides on Node.js/Express/MongoDb (Github entire code) and Reactjs (Github entire code). Sam ...

javascriptnode.jsreactjsmongodbexpress

Automatically scrolling through a nested list in ReactJs

I have a chat list integrated into my web application. The entire webpage is scrollable, as shown in the image at the bottom. I would like the messages list to automatically scroll to the bottom whenever a new message arrives. To achieve this, I created a ...

javascriptnode.jsreactjs

Are there any instances where CSS is overlooking certain HTML elements?

In the following HTML code snippet, the presence of the element with class ChildBar is optional: <div class="Parent"> <div class="ChildFoo"></div> <div class="ChildBar"></div> <!-- May ...

javascripthtmlcss

Locate a specific element within an array and retrieve its corresponding index

Need help updating a boolean property for all objects in an array with the same user ID. I've outlined my MVC framework below in a concise manner. Model: var posts = [{id:1, user_id:1, is_following:true}, {id:2, user_id:1, is_cool:true}, ...

javascriptangularjs

A guide to displaying a PDF preview using React Dropzone

I am struggling to find a way to display previews of PDF files that I'm uploading using react-dropzone. Although PNG and JPG files are working correctly, I would like to be able to show the user either the actual PDF or an image representation of it. ...

javascriptreactjspdfdropzonereact-dropzone

Using a Regex Pattern to Validate Password Strength

var pattern = /^(?=.*[a-z])(?=.*[A-Z])(?=.*\d)(?=.*[!@#$%^&*()~])[a-zA-Z0-9!@#$%^&*()~]+$/; var password = document.getelementbyId("txtPassword").value; if(!pattern.test(password)) { alert("Invalid Password. Please make sure it contains at ...

javascriptjqueryregex

The "angular2-image-upload" npm package encountering a CORS issue

Using the angular2-image-upload library for uploading files has been a smooth process until recently. After upgrading from version 0.6.6 to 1.0.0-rc.1 to access new features in future, I encountered issues with image uploads. The errors I faced were: Tr ...

javascriptangularnpmcors

Display the Material UI Switch in an active state even when the "checked" value is set to false

While using Material UI Switches with Formik, I've encountered an issue. When I toggle the switch to 'enable,' it automatically sets the value in Formik to "true," and when I toggle it to 'disable,' it sets the value in Formik to " ...

javascriptmaterial-uiformik

Using Vue.js and JavaScript to access a single variable across multiple class methods

I am working on organizing my custom channel logic into its own class. During the created lifecycle method, I am executing each method in the class I created. However, I am facing a challenge in retaining the instance of the socket that was created in the ...

javascriptvue.js

How do I set up Firebase functions to trigger onWrite when listening for a specific child just once?

Is there a way to access the child under a different node each time the Firebase onWrite function is triggered? To retrieve this child, you can use the following code: {const saatt = (context.database.ref('kullanicilar/1111/marina1/2021/1saat'). ...

javascriptnode.jsgoogle-cloud-functions

JavaScript code to activate a text box when a checkbox is clicked

I have a dynamic table that is generated by JavaScript based on the selected item from a dropdown list. The table consists of a column for checkboxes, a column for displaying names, and a column for inputting quantities. I would like to have all textboxes ...

javascriptc#jqueryasp.netasp.net-mvc

Optimal method for parsing URLs using ES6

There have been many remarkable inquiries regarding this topic, such as: how to parse a url. However, as time has gone by, the answers I come across are outdated. I am looking for a more modern and flexible method to parse URLs, without relying on regular ...

javascripturlnpmecmascript-6

Trigger function when the element is generated

Is there a way to execute a function only once while still having it run each time a new element is created using v-for? <div v-for"value in values"> <div @ function(value, domElement) if value.bool===true @> </div> ...

javascriptvue.js

Chrome's keyup event restricts the use of arrow keys in text fields

Could you please test this on Google Chrome browser: jQuery('#tien_cong').keyup(function(e) { jQuery(this).val(jQuery(this).val().replace(".", ",")); var sum = 0; var tien_cong = jQuery('#tien_cong').val(); tien_cong = tien_ ...

javascriptjquerygoogle-chrome

How can you determine the status of an individual checkbox within a reactjs (material-table) component?

In my project, I have implemented a table that displays a list of students retrieved from a database. Upon clicking on each student row, a modal popup appears showing another table with 4 rows and 3 columns. Each column in the modal contains 4 checkboxes. ...

javascriptreactjscheckboxmaterial-uimaterial-table