iOS device encounters failure with Ajax CORS request and redirect

I am experiencing an issue where a URL is being redirected to another domain by the server. My test code is very simple:

$.ajax({
        type:"GET",  
        url:"{MYURL}",  
        success:function(d){alert('response');}  
 })

You can check out the live script here.

Despite receiving the "response" alert on all browsers and platforms, I am facing an issue with iOS (iPhone/iPad) which displays the error message "Cannot make any requests from null". Any assistance would be greatly appreciated.

Ofer

javascriptiosajaxcors

Answer №1

Looks like there was a glitch in the iOS system
The issue seems to be resolved in iOS version 10.1.1

Similar questions

If you have not found the answer to your question or you are interested in this topic, then look at other similar questions below or use the search

Using JS regular expressions to only select anchor (a) tags with specific attributes

When trying to select a link tag (a) with a specific data-attr, I encountered an issue. I currently use the following regex pattern: /<a.*?data-extra-url=".*?<\/a>/g. However, I noticed that this selection goes wrong when there are no line br ...

javascripthtmlregex

What is the best way to ensure that the operations are not completed until they finish their work using RX

Is there a way to make RXJS wait until it finishes its work? Here is the function I am using: getLastOrderBeta() { return this.db.list(`Ring/${localStorage.getItem('localstorage')}`, { query: { equalTo: fa ...

javascripttypescriptionic2angularfire

Achieving a task with the utilization of jQuery's `onchange` event handler, which mirrors the functionality of an `@Ajax

I have an ajax request that generates a link which, upon being clicked, replaces my "testDiv" div with some information obtained from my controller through the "ControllerMethod" function: <div class ="editor-field" id ="clickableAjax"> @Ajax.Ac ...

jqueryajaxasp.net-mvc

Can you explain the distinction between ajaxComplete and beforesend when making an Ajax call with JavaScript?

Can you explain the usage of ajaxComplete and beforesend? What sets them apart from each other? Are there any alternative methods similar to success when making an Ajax call? ...

javascriptjqueryajax

Using HTML and JavaScript to create a link that appears as a URL but actually directs to a JavaScript function

I am working on an HTML page and I am trying to create a link that appears to go to 'example.html' but actually goes to 'javascript:ajaxLoad(example.html);'. Here is what I have tried: <a href="example" onclick="javascipt:ajaxLoad( ...

javascripthtmlhttp-redirecthyperlink

Having trouble getting anime.js to function properly in an Ionic 3 project?

I have been attempting to incorporate anime.js into my Ionic 3 project, but I keep encountering an error when using the function anime({}) in the .ts file. Error: Uncaught (in promise): TypeError: __webpack_require__.i(...) is not a function TypeError: _ ...

javascriptangulartypescriptionic2

The route handler for app.get('/') in Express is not returning the input data as expected

I have multiple routes set up, and they are all functioning properly except for the app.get('/') route. When I navigate to 'localhost:3000/', nothing is being displayed in the backend console or on the frontend. The Home component is su ...

javascriptexpressroutesnodesbackend

Discovering the version of the Javascript library utilized on a website - a step-by-step guide

My quest is to uncover the versions of JavaScript libraries being utilized by popular websites. By using phantomjs.exe, I successfully identified the version information for jquery. However, I am currently at a loss on how to expand this capability to inc ...

javascriptjqueryangularjsnode.jsweb

When you click on the "email" link, the Email app will automatically launch

Is there a way I can make the "EMAIL" text clickable in HTML, so that it automatically opens an email app or site and inserts the clicked email into the "To:" field? ...

javascripthtml

Library for visualizing JavaScript code using flowcharts and diagrams

Is there a jQuery-based javascript library available for client-side rendering and manipulation of flow-charts? I am open to other options as well. This question has been previously posed, but has not been revisited in a few years. Hopefully, there are ne ...

javascriptjqueryworkflowflowchart

Inquiry on integrating Spotify with Axios for my debut solo project (beginner inquiry)

I have a question regarding my first solo project in React. I started learning code in September and I'm facing an issue while making a POST request to the Spotify API to retrieve an access token: Despite following the recommended 'Content-Type& ...

javascriptreactjsaxiosspotify

Error: The constructor for JsSHA is not valid for the TOTP generator

Attempting to create a TOTP generator similar to Google's timed-based authenticator using the React framework. I am utilizing the bellstrand module for TOTP generation, but I am encountering issues when trying to import it into my React code. Here is ...

javascriptnode.jsreactjs

Exploring the Function Scope within ViewModel

I have been facing an issue while trying to call a function from my ViewModel within a foreach loop. It seems like the function goes out of scope as soon as I call it. Being new to JavaScript, I am struggling to understand why this is happening. Here is t ...

javascriptjqueryknockout.js

A step-by-step guide on enhancing error message handling for Reactive forms in Angular

Here is a code snippet that I'm working on: public errorMessages; ngOnInit(): void { this.startErrorMessage(); } private startErrorMessage() { this.errorMessages = maxLength: this.translate.instant(' ...

javascriptangulartypescriptformsangular-reactive-forms

How can I adjust the width of a handle/thumb for NoUiSlider?

Looking to adjust the width of a NoUiSlider using CSS: .noUi-horizontal .noUi-handle { width:8px; height:25px; left: 0px; top: -8px; border: 0px solid #000000; border-radius: 0px; background: #000; cursor: default; box- ...

javascriptcssnouislider

React dynamic dropdown selection based on previous dropdown values

I have implemented 3 react input fields that are populating data to a useState Hook <FormControl fullWidth> <InputLabel>Primary Goal</InputLabel> <Select ...

javascriptreactjsmaterial-ui

What is preventing me from accessing my session array in this.state.props from my mapStateToProps in React-Native Redux?

I am currently facing an issue with my Redux store setup. I am attempting to store an array of Session objects, where each Session object contains an array of Hand objects. However, when trying to access my store using `mapStateToProps`, none of the option ...

javascriptreactjsreact-nativereduxreact-redux

Ajax: Understanding the Difference Between Definition and Implementation (Comparing XML, JSON, and Alternatives)

Do you prefer using AJAX, which stands for Asynchronous JavaScript And XML, or do you lean towards JSON as an alternative? Personally, I have found JSON to be smaller, easier, and more efficient for transmitting data. Which technology do you use to communi ...

xmlajaxjsondefinition

What could be causing the d3.js pie chart transition to malfunction?

Today I am experimenting with d3.js to create a unique pie chart from scratch. While following tutorials here as my base, there were modifications made in the code to add personal touches and customization. The challenge arose during Step 6 when introduc ...

javascriptpythond3.jscharts

What steps should be taken to refresh an Expo app block once new data is retrieved from the database

I'm facing an issue with connecting my expo app to a database. I have utilized react redux to fetch data from the database, and upon successful retrieval of data, I aim to update my furniture block with the obtained information. However, despite recei ...

javascriptreactjsredux