Exploring Protractor testing with Bootstrap modals

I'm having an issue testing a bootstrap modal.

Here's the scenario:

  • Click on a button to display the modal
  • The modal body has a list of buttons
  • When I click on one of them, it doesn't do anything

My Protractor code snippet:

element(by.model('$root.project.modules.manufacturer.name')).click();
element.all(by.css('[ng-click="thisManuf(manufactur.name,manufactur.id);$hide(); "]')).get(0).click();

Error message received:

UnknownError: unknown error: Element is not clickable at point (584, 170). Other element would receive the click: ...

Can someone please help me with this?

javascriptangularjstwitter-bootstrapselenium-webdriverprotractor

Answer №1

Locate the buttons using the method of exact repeater:

var buttonGroup = element.all(by.exactRepeater("manufactur in manufacturs"));
buttonGroup.first().click();

Similar questions

If you have not found the answer to your question or you are interested in this topic, then look at other similar questions below or use the search

Having trouble with filtering JSON data in AngularJS?

I'm sorry if this question has already been answered. I tried looking for solutions on other websites, but couldn't understand them. I am attempting to filter JSON data within the ng-repeat function, but whenever I try to input something, it does ...

javascriptjsonangularjsfilter

Show the total of a JavaScript calculation in a designated input box

Is there a way to show the total sum of this calculation in an input field? function calculateSum1() { var sum = 0; //loop through each textbox and add their values $("input.miles").each(function() { //only add if the value is a number ...

javascriptjquery

Unexpected null value returned upon form submission with Mongoose and ExpressJS

I am encountering an issue with sending data from a basic HTML form to MongoDB using Express. When I try to post it, I am getting null as the result. The Schema I used is: commentname: String. Below is the snippet of the HTML code: <form id="form ...

javascriptnode.jsexpressmongoosemongoose-schema

Using JavaScript to parse JSON data generated by PHP using an echo statement may result in an error, while

I am facing an issue with parsing a JSON string retrieved from PHP when the page loads. It's strange that if I send an AJAX request to the same function, the parsing is successful without any errors. The problem arises when I attempt to do this: JSON ...

javascriptjsonajax

Is it possible for Tinymce to provide me with precise HTML content that retains all styles (essentially giving me a true WYSIWYG

I find it puzzling how Tinymce is labeled as a WYSIWYG editor when what I see visually is not exactly what I get when I retrieve the HTML using getContent(). It seems more like "what you see is just what you see." Currently, when I use getContent() to get ...

javascripthtmlcsstinymcewysiwyg

What is the process for renaming a Discord channel through nodeJS and discordJS?

I'm currently developing my first Discord bot using node.js and discord.js. My objective is to provide real-time information about a Minecraft server through Discord. What I aim to achieve is to have a channel that automatically updates its name per ...

javascriptnode.jsdiscord.js

I was assigned to calculate and transfer the length of the string within the parentheses (written in javascript)

function formatString(str) { const formatted = str.split(',') .map(subStr => `${subStr}(${subStr.length})`) .join(', '); return formatted; } The expected output was "hello(5), world(5), abra(4), carabfa(7), r ...

javascriptstring

AngularJS losing data binding without any errors being thrown

It seems I am struggling to create complex data models in my controllers. Every time I attempt to do so, the code fails silently. Simple data models like $scope.conversationList = [123456]; work perfectly fine using ng-bind and when used in a directive te ...

angularjsgoogle-chrome-extensionangularjs-directiveangularjs-scope

What is the process of importing a JSON file in JavaScript?

Is there a way to import a JSON file into my HTML form by calling $(document).ready(function (){});? The properties defined in the JSON file are crucial for the functionality of my form. Can anyone guide me on how to achieve this? ...

javascriptjqueryjson

Failed Axios POST request on iOS devices

Attempting a straightforward ajax POST from domain1 to domain2 using Axios. This involves a cross-domain simple POST without requiring a PREFLIGHT (OPTIONS) call. The response returned by the application is a basic JSON string. This process functions smoo ...

javascriptiosajaxlaravelaxios

What method does the framework use to determine the specific API being accessed?

How can the framework determine which API is being accessed? app.get('/user/:userId/name/export', function (req, res) { var userId = req.params.userId; } app.get('/user/:userId/name/:name', function (req, res) { var userId = req ...

javascriptnode.jsexpressgateway

Stacking items when clicked on with jQuery UI Draggable

Can a draggable's stack procedure be activated by clicking instead of just dragging? I came across this solution, which essentially replicates the library code (with an important addition I included below). Is there a more elegant approach to achieve ...

javascriptjqueryjquery-ui

Accessing an element by its ID with the help of a looping

Looking to retrieve a string from my database and insert it into my paragraphs: <p id="q_1"></p> <p id="q_2"></p> The following code works correctly: $.get("bewertung/get/1", function (data) { document.getElementById("q_1") ...

javascriptjqueryhtmlnode.jsexpress

encountering obstacles during the process of scraping data from Kickstarter

from selenium import webdriver from selenium.webdriver.chrome.service import Service from selenium.webdriver.chrome.options import Options from selenium.webdriver.common.by import By from selenium.webdriver.support.ui import WebDriverWait from selenium.web ...

selenium-webdriverweb-scraping

Is randomly pairing 2 datapairs after slicing a JSON array easy or challenging?

There is a JSON file containing an unlimited number of users [{ "fname": "Hubert", "lname": "Maier", "email": "<a href="/cdn-cgi/l/email-protection" class="__cf_email__" data-cfemail="bd ...

javascriptarraysjson

Executing a Javascript function within a PHP script

I am trying to retrieve JSON data from a JavaScript function and use it as a variable in PHP. Here is the function I have: <script type="text/javascript" src="Scripts/jquery-1.9.1.min.js"></script> <script> $(fu ...

javascriptphpjson

Aggregate the properties of objects in an array into a single object using Lodash

I've been struggling to figure this out on my own, so I decided to seek advice from those with more experience. I have an array of objects called items, and I need to sum up specific properties across different objects in the array. The user can selec ...

javascriptarraysunderscore.jslodash

The AJAX function triggers repeatedly upon each click

There is a form with two buttons: save & continue and save and exit. Each button has its own id, save_cont and save_exit respectively. When clicking the second button, the ajax action of the first button is triggered as well, preventing the URL redire ...

javascriptphpjqueryajaxlaravel

Using the OR Operator with a different function in React

Struggling with setting the day flexibility using disableDate(1,2,3,4,0) but it's not functioning as expected. Can you assist me in fixing this issue? Here is the function snippet: const disableDate = (date) => { const day = date.day(); retur ...

javascriptreactjsmaterial-ui

Validating groups of fields using Angular fieldsets

AngularJS validation is working well with ng-required. However, I am interested in checking if all the form elements within my fieldset are valid. <form> <fieldset> <legend> Part one <img src="/co ...

javascripthtmlangularjsformsvalidation