"Encountering a Dojo error where the store is either null or not recognized

I encountered an issue with the function I have defined for the menu item "delete" when right-clicking on any folder in the tree hierarchy to delete a folder. Upon clicking, I received the error message "Store is null or not an object error in dojo"

Can someone advise me on how to resolve this error? Is there something incorrect in my function provided below?

<ul dojoType="dijit.Menu" id="tree_menu" style="display: none;">   
      <li dojoType="dijit.MenuItem" data-dojo-props="disabled: false,
                                     onClick: function (evt){
                                     store.deleteById(selectedItemId);
                                     resetEditor();
                                 }",>Delete project</li></ul>

Tree Structure

- Main Project 1 
Sub Project 1_1  
Sub Project 1_2
 * sub Project 1_3 

+ Main Project 2 - 
Main Project 3 

Sub Project 3_1 - 
Sub Project 3_2 
Sub Project 3_2_1
javascriptdojo

Answer №1

It seems that when the onClick function is executed in the MenuItem context, 'this' points to the instance of the MenuItem widget.

In order to utilize your store variable within the onClick method, you can first declare it in your widget like so:

<ul dojoType="dijit.Menu" id="tree_menu" style="display: none;">   
  <li dojoType="dijit.MenuItem" data-dojo-props="disabled: false,
                                 _store: store,
                                 onClick: function (evt){
                                 _store.deleteById(selectedItemId);
                                 resetEditor();
                             }",>Delete project</li></ul>

Alternatively, you can access your global store object in the window context:

<ul dojoType="dijit.Menu" id="tree_menu" style="display: none;">   
  <li dojoType="dijit.MenuItem" data-dojo-props="disabled: false,
                                 onClick: function (evt){
                                 window.store.deleteById(selectedItemId);
                                 resetEditor();
                             }",>Delete project</li></ul>

Similar questions

If you have not found the answer to your question or you are interested in this topic, then look at other similar questions below or use the search

Transferring time between functions in Vue.js: A journey from one function to another

Struggling to pass the value from checkMp3SizeAndDuration method function to data() {return { time: '' } } Check out the code snippet below: data () { return { time: '' } }, methods: { checkMp3SizeAndDuration ...

javascriptfunctionvue.jsmethods

Comparing ng-transclude usage: element or attribute styling

Creating a wrapper directive to frame a notification widget within a list is my goal. I plan to transclude specific content based on a property from the 'notif' object into this frame. Currently, I have hardcoded a 'div' element. The i ...

javascriptangularjsangularjs-directivetransclusionangularjs-ng-transclude

What is the best way to showcase an item from an array using a timer?

I'm currently working on a music app and I have a specific requirement to showcase content from an array object based on a start and duration time. Here's a sample of the data structure: [ { id: 1, content: 'hello how are you', start: 0 ...

javascriptarraysreactjsreact-hooks

How to Exclude ress.css in Vuetify.js

How can I prevent ress.css from conflicting with Bootstrap and my custom styles in Vuetify? I attempted to remove it from the Vuetify directory within node_modules, but that did not resolve the issue. ...

javascriptcsslaravelnpmvuetify.js

Creating TypeScript Classes - Defining a Collection of Objects as a Class Property

I'm trying to figure out the best approach for declaring an array of objects as a property in TypeScript when defining a class. I need this for a form that will contain an unspecified number of checkboxes in an Angular Template-Driven form. Should I ...

javascriptangulartypescriptoop

Phonegap application functioning smoothly on computer, encountering issues on mobile device

Hey there! I recently developed a phonegap app that retrieves JSON data from a YQL link and presents it to the user. It works perfectly on Google Chrome desktop, but my client mentioned that it doesn't work on his Android 2.3 device. Could you help me ...

javascriptandroidhtmlcordova

Fetching Data Using Cross-Domain Ajax Request

Seeking assistance with a cross-domain Get request via Ajax. The code for my ajax request is as follows: var currency_path = "http://forex.cbm.gov.mm/api/latest"; $.ajax({ url: currency_path, crossDomain:true, type:"GET", dataTyp ...

javascriptajaxcross-domain

What is the method for concatenating two strings in JavaScript without any whitespace in between?

When working with two strings involving time, consider the following scenario: var gettime= $("#select-choice-2 :selected").text(); The above code returns a time value in 24-hour format, such as 17:45 However, if you require the time to display in the ...

javascript

The element div is not permitted as a child of the element h5 in this particular scenario

My code snippet is as follows: $compile .= "<h5 data-count='".$acctemmpi. "' class='shortcode_accordion_item_title expanded_". $expanded_state . "'>" . $title . "<div class='ico'&g ...

javascripthtmlcss

Tips for correctly linking an Event Listener to the worldwide 'window' in Angular 6 and higher

Situation Within our Angular 6 application, an iframe is embedded to showcase third-party data. To facilitate secure cross-domain communication, the child iframe sends messages to the parent Angular app using window.postMessage() API. To receive these mes ...

javascriptangulardomiframepostmessage

Exploring the Adjustment of State as well as Function in Next/React JS

I'm facing a challenge in my React project where I need to manage state and trigger a function across separate component files. Specifically, I have my main app file along with two components (header and sidebar) stored in the components folder. The h ...

javascriptreactjsnext.js

What is the best way to determine if two external values are equal within a mongodb criteria object?

Consider the following collection: {id: 1, name:"abc"}, {id: 2, name:null} When testing a property, I typically use this method: db.collecton.find({name:"abc"}, {name:1}); // This will return the first document. Now, I want to incorporate two external ...

javascriptnode.jsmongodb

Guide on adding user input values (type=text) into HTML using JavaScript function outcome

I'm looking for a way to use the output of a JavaScript function as the value for an input field in HTML. Currently, I have a JavaScript function that generates a random string: function generateRandomString(length) { let result = ''; ...

javascripthtmlinput

Steps to deactivate two choices in a multi-select dropdown menu and visually dim those options

Hey there, I recently worked with Angular8 and Bootstrap 4. I utilized a Bootstrap multi-select dropdown, where I encountered an issue: specifically, I'm trying to disable and gray out the options for PL Marketing and CL Marketing but have been unsucc ...

javascriptjqueryangular

What is the recommended method for obtaining the maximum suggested number for the y-axis?

How do I determine the suggestedMax value for the yAxes scale? For instance, in the provided image, it is 4000 for legend2 and 400 for legend1) Legend Label 1: Legend Label 2: var canvas = document.getElementById('myChart'); var data = { l ...

javascriptcanvaschart.js

The distinction between a keypress event and a click event

Due to my eyesight challenges, I am focusing on keyboard events for this question. When I set up a click event handler for a button like this: $("#button").on("click", function() { alert("clicked"); }); Since using the mouse is not an option for me, ...

javascriptjqueryeventsjquery-ui-autocompletescreen-readers

What is the best way to capture GotError [HTTPError]: When the response code 404 (Not Found) occurs in a nodejs

If the URL provided is incorrect and the Got module raises a HTTPError, how can I properly catch the error? Using try-catch does not seem to be effective in this situation. const got = require('got'); got(`https://www.wrongurl.com`) ...

javascriptnode.jshttp-errornode.js-got

To ensure a successful redirection process without information loss, it is essential to address any potential issues with data input into

How can I properly implement a page redirection? Below are the relevant code snippets. <link rel="stylesheet" type="text/css" href="payout.css"/> <font face='calibri'> <?php session_start(); $conn = @mysql_connect("localho ...

javascriptphpmysqlhttp-redirect

What is the best way to eliminate the bottom border of an input field?

Seeking advice on how to eliminate the border-bottom of an input field when typing starts. .car-list-input { font-family: 'Source Sans Pro', sans-serif; border-radius: 3px; font-size: 14px; font-weight: 400 !important; height: 35px; ...

javascriptjqueryhtmlcss

fade in and out twice (for beginners)

Jquery <script> //Code snippet $(document).ready(function(){ $(".team").click(function(){ $(".panel").fadeToggle("3000"); }); $(".team").click(function(){ $(".teamh").fadeToggle("3000"); }); }); </script> HTM ...

javascriptjqueryhtmlcss