Bring back Telerik RadWindows with dynamic content on the next page load

Currently, I am working on ASP using Telerik components.

Within my webpage, I have incorporated 2 buttons called Create Window and Postback. The functionality behind the Create Window button involves creating a new RadWindow dynamically upon its click event (client-side) by utilizing window.radopen(). As for the Postback button, it triggers a simple postback. However, the issue I am encountering is that the windows disappear after each postback. How can I ensure that my RadWindows remain open even after a postback, retaining their content and position?

In case there is no inherent method to restore my dynamic RadWindows, kindly advise me on how to store the current windows' content to reload manually during the subsequent postback. My initial thought was to utilize a Hidden control to save the RadWindow's position and content. Nevertheless, I am unsure of how to implement this considering the window's content consists of a user control with numerous textboxes, and redoing all the data entry would be inconvenient for the user.

javascriptasp.netdynamictelerikradwindow

Answer №1

When the RadWindows are displayed for the first time, they are dynamically generated using JavaScript. You can verify this by utilizing your preferred developer plugin. These windows create a wrapper div directly under the form element once displayed. Since they do not undergo server-side rendering, they cannot be saved on the server during postbacks.

To work around this limitation, you can implement AJAX - have the button trigger an AJAX request to update specific content on the page while excluding the RadWindows from the update process. Refer to this helpful article that explains how to integrate AJAX with RadWindow: http://www.telerik.com/help/aspnet-ajax/radwindow-ajaxifying.html.

Similar questions

If you have not found the answer to your question or you are interested in this topic, then look at other similar questions below or use the search

Storing data for extended periods in NodeJS

Currently, I have a node server up and running. To maintain its uptime when I'm not actively developing, I utilize npm forever. However, for editing purposes (such as restarting the app upon edits or uploads), I rely on npm nodemon. After restarting ...

javascriptmysqlnode.jsangularjsexpress

Using this functionality on a ReactJS Functional Component

Hey everyone, I'm fairly new to using React and I'm currently trying to wrap my head around some concepts. After doing some research online, I stumbled upon a situation where I am unsure if I can achieve what I need. I have a functional componen ...

javascriptreactjsvalidation

Is it possible to seamlessly integrate both C# and VB.aspx in a single project?

Is it possible to merge assemblies if you have a VB.net web app and a C# project? Specifically, how would you go about merging the aspx pages in this scenario? Wondering if this can be achieved successfully. ...

asp.net

Managing unanticipated errors in Express while utilizing async/await mechanics

Consider this TypeScript code snippet: app.get('/test_feature', function (req: Request, res: Response) { throw new Error("This is the bug"); }); app.use(logErrors); function logErrors (err: Error, req: Request, res: Response, next: NextFun ...

javascriptexpresstypescripterror-handlingasync-await

Following the build process with the --prod flag in Ionic 3, users may encounter a situation where

Encountering an issue only when using --prod on Android phones. Strangely, touching anywhere triggers the event that should be fired at that specific location, causing the content to suddenly appear. I came across information suggesting a conflict between ...

javascriptangulartypescriptionic2ionic3

Can the MaskedEditExtender be utilized for inputting an IP Address?

Currently, in my application, I am utilizing the AjaxControlToolKit along with the MaskEditExtender on a TextBox. The purpose of this TextBox is to capture data such as an IP address format (e.g. 999.999.999.999 OR 999.999.999.*). While I have successfull ...

c#asp.netvisual-studio-2008ajaxcontroltoolkitmaskededitextender

Error in VUE: Module 'lru-cache' not located

Greetings, I would like to start by apologizing for any language errors in my communication. I am currently facing an issue while trying to set up a project to work on, following these steps. STEP 1: npm install @vue/cli STEP 2: vue create myproject En ...

javascriptnode.jsvue.js

Adding a hash to asset paths in NextJS static builds

After running next build && next export, I receive a directory named out, which is great. When examining the source code, such as in the index.html file, it requests assets from <link rel="preload" href="/_next/static/css/styles.aa216922.chunk. ...

javascriptnext.js

Using jQuery to gradually diminish the text content within a text field

I am facing a challenge that has me scratching my head. Despite being well-versed in jQuery and JavaScript, I can't seem to figure this out. I've developed a basic plugin that clears a text input upon focus and displays the default value if no te ...

javascriptjqueryframeworks

Error message indicating a problem with the locator By.linkText that contains dots in Selenium: TypeError - Invalid locator

I've searched through other resources for solutions, but I can't find anything that addresses my specific issue. The error message I'm encountering is TypeError: Invalid locator. Here's a snippet of my code (where I suspect the problem ...

javascriptseleniumselenium-webdriverlinktextpartiallinktext

Struggling to implement ng-repeat in AngularJS

I'm currently facing an issue with ng-repeat (ng-repeat="a in student.store") in my Angular code. It doesn't show any output or errors. Any suggestions on how to fix this? ============================== My Angular Code var module = angular.mod ...

asp.netangularjsasp.net-mvc

Retrieving information from a public Google spreadsheet using client-side JavaScript

How can I retrieve cell values from a public Google spreadsheet? GET https://sheets.googleapis.com/v4/spreadsheets/1vW01Y46DcpCC7aKLIUwV_W4RXLbeukVwF-G9AA7P7R0/values/A1A4?key=abcdef The above request returns a 403 error. I also included the Referrer ...

javascriptgoogle-sheetsgoogle-sheets-api

A guide on applying bold formatting to a specific section of text in React

I have a collection of phrases structured like so: [ { text: "This is a sentence." boldSubstrings: [ { offset: 5, length: 2 } ] } ] My goal is to display each phrase as a line using the following format: ...

javascriptcssreactjs

What steps should I take to ensure that elements beneath a div are made visible?

I've been working on a unique project to create a website with "hidden text" elements. One of the cool features I've developed is a circular div that follows my mouse cursor and flips all text below it using background-filter in both CSS and Jav ...

javascripthtmljquerycss

Does Google's web crawler have the ability to index content created by javascript?

Our web app generates content using javascript. Can Google index these pages? In our research on this issue, we primarily found solutions on older pages suggesting the use of "#!" in links. Within our app, the links are structured as follows: domain.co ...

javascriptajaxweb-applicationsgooglebotgoogle-crawlers

Transferring information from Context.Request to HttpWebRequest

How can I efficiently forward a request from an Aspnet handler (ashx) to another handler on a different server? Is there a simple method to transfer the content of Context.Request to HttpWebRequest, or is manual copying of headers and content necessary? ...

c#asp.net

Using Javascript to retrieve the childNode

I have encountered a challenge that I am struggling to overcome. My issue involves utilizing a dynamically generated table with 4 columns: a checkbox, text values, and a hidden input. echo "<tr><td><div class='input-containerh'> ...

javascripthtml

Dynamically load highcharts with a dynamic configuration setting

I am currently utilizing highcharts and dynamically loading them using ng-repeat. <div ng-repeat="(key,value) in chartCheckboxes track by $index"> <div class="card" id="{{key}}"> <div class="card-body" id="{{key}}"> ...

javascriptjqueryangularjshighcharts

Attempting to forward an image in a node-js/express application

I am facing an issue with a broken image link when trying to access it through Express: app.get('/fileThumbnail', function(req, res) { var url = proxiedURL +"?" + querystring.stringify(req.query); logger.info('/fileThumbnail going to url& ...

javascriptphpnode.jsexpress

Hash Symbol refuses to function in IFRAME

The Request.QueryString contains the file path example Temp\file#hashName.jpg protected void Page_Load(object sender, EventArgs e) { string filePath = Request.QueryString["fileName"]; iframes.Attributes.Add("src", filePath); } It then goes to the Ma ...

c#javascriptasp.net.net-3.5